| Product Name | Big Gastrin - 1, humanPyr - LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF - NH2 |
| Size | 0.5 mg |
| Catalog # | AS-20747 |
| US$ | $267 |
| Purity | % Peak Area By HPLC ≥ 95% |
Big Gastrin is also referred to as Gastrin-34. Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach. Secreted by the G cells in the gastric mucosa, it is one of the major bioactive forms of gastrin found in tissue and plasma (the other bioactive form is gastrin-17 or little gastrin - Cat# AS-20750). Both gastrin-17 and gastrin-34 are carboxy-amidated and partially tyrosine sulfated. Binding of gastrinto the CCK2/gastrin receptor requires carboxy-amidation, however sulfation is not necessary for binding to the receptor. Binding of Gastrin to the CCK2/gastrin receptors on parietal cells of the stomach causes them to secrete hydrochloric acid (HCl) and stimulates lectin-like protein Reg expression via activation of PKC and RhoA. Gastrin also plays a role in release of Histamine and Pepsinogen. | |
| Detailed Information |  Material Safety Data Sheets (MSDS) |
| Storage | -20°C |
| References | Choudhury, A. et al. Hoppe-Seylers Z Physiol Chem 361, 1719 (1980)Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x.OConnor A. et. al. Digestive Dis 32, 186 (2014), doi: 10.1159/000357848Dockray, G. et.al. Pflügers Archiv 449,344 (2005)Bundgaard, JR. et al. J Biol Chem 272, 21700 (1997), doi: 10.1074/jbc.272.35.21700Yakabi, K. et al. World J Gastroenterol 14, 6334 (2008), doi: 10.3748/wjg.14.6334 |
| Molecular Weight | 3849.3 |
| Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2 | |
| Sequence(Three-Letter Code) | pGlu - Leu - Gly - Pro - Gln - Gly - Pro - Pro - His - Leu - Val - Ala - Asp - Pro - Ser - Lys - Lys - Gln - Gly - Pro - Trp - Leu - Glu - Glu - Glu - Glu - Glu - Ala - Tyr - Gly - Trp - Met - Asp - Phe - NH2 |
