
Product Name | Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, humanHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2 |
Size | 1 mg |
Catalog # | AS-22463 |
US$ | $238 |
Purity | % Peak Area By HPLC ≥ 95% |
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreaticbeta cells.It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460).Both GLP-1 (7-36) andGLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin.GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4),which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles.DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation. | |
Detailed Information | ![]() ![]() |
Storage | -20°C |
References | Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197 |
Molecular Weight | 3297.7 |
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | |
Sequence(Three-Letter Code) | H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2 |
Product Citations | Tashiro Y et al. (2014) A glucagon-like peptide-1 analog liraglutide suppresses macrophage foam cell formation and atherosclerosis; Peptides 54, 19-26. Puddu A et al. (2010) Glucagon-like peptide-1 counteracts the detrimental effects of Advanced Glycation End-Products in the pancreatic beta cell line HIT-T 15. Biochem Biophys Res Commun 398, 462. |